SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A285PY62 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A285PY62
Domain Number 1 Region: 109-201
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000000811
Family Pseudo ankyrin repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A285PY62
Sequence length 216
Comment (tr|A0A285PY62|A0A285PY62_9VIRU) Ankyrin repeat {ECO:0000313|EMBL:SOB74132.1} OX=2023205 OS=Cedratvirus lausannensis. GN=BQ9231_00249 OC=Viruses; dsDNA viruses, no RNA stage; unclassified dsDNA viruses.
Sequence
MEAVLETIFSFSGGYNFLNRQVCREFRELAPEVDNLEYLNQAIHDGYKPENFIPTSKLAD
LALEKGLLPLLESCSDFVSEDVCKRAAGKGYLHILQWARVQRYSWDYKVCSEAAYNGHLE
TLQWARVNGCDWSAHTFLSAAAGGHLDILQWCKEQDCPVDGNNCRIAASFGQLDALKWCV
EQGYPIDENAYIAADPKKHKHVIQWLEEIGIERPDM
Download sequence
Identical sequences A0A285PY62

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]