SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A285Q1Y1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A285Q1Y1
Domain Number 1 Region: 84-205
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000000000235
Family Pseudo ankyrin repeat 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A285Q1Y1
Sequence length 242
Comment (tr|A0A285Q1Y1|A0A285Q1Y1_9VIRU) Ankyrin repeat {ECO:0000313|EMBL:SOB74020.1} OX=2023205 OS=Cedratvirus lausannensis. GN=BQ9231_00137 OC=Viruses; dsDNA viruses, no RNA stage; unclassified dsDNA viruses.
Sequence
MEIVQRTIFSFSEGYNFRNRQVCSYFREMIPKVRNLFYLDILCRDNRVPKEIKSNEKLAK
KAVSLGLVNILDWCDKEHIPKYFCQTAAKKNRVEVLEWARKNNYPYDEEIPSTAAIHGNL
EVLQWVHDNKLSWDEETCDDAAYGGYLEVLQWLREHDCPWDEDVCSSAAMEGHLELLQWA
RANGCPWNEDTCSSAAMEGHLEVLKWARANGCPWDERTHYNARRNGHLEVLKWALDNGCP
QE
Download sequence
Identical sequences A0A285Q1Y1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]