SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A285Q2A4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A285Q2A4
Domain Number 1 Region: 92-196
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 1.44e-16
Family Pseudo ankyrin repeat 0.011
Further Details:      
 
Domain Number 2 Region: 168-264
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000746
Family Ankyrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A285Q2A4
Sequence length 301
Comment (tr|A0A285Q2A4|A0A285Q2A4_9VIRU) Ankyrin repeat {ECO:0000313|EMBL:SOB74150.1} OX=2023205 OS=Cedratvirus lausannensis. GN=BQ9231_00267 OC=Viruses; dsDNA viruses, no RNA stage; unclassified dsDNA viruses.
Sequence
MNLVPREIILCVLEFSGPYNFENRQVCSEFRLLAEKVDPLVYLDRLITDARPVEEFVPSE
NTIKQAVDKQLLGLLSFIKEYLPKNLCDVAALTGKLQTLQWAVKNDFKFTDSTYRYAVRR
GHLDILKWLKEQDCLLYFNVCTEAAFYGHLHVLQWLREQGCTWDESTFSAAARNGHLKVL
QWCRENSCPWDEYTCSNAVSGGHLEILKWCREQGCPWHEITFNSAVYVGDLETLQWLKEQ
GCPWNEETCSTAAYTGNLLVLQWLRANGCPWDYGTIVEAIDQEHPKVYEWARANGCPNEY
A
Download sequence
Identical sequences A0A285Q2A4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]