SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A285Q2W7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A285Q2W7
Domain Number 1 Region: 101-214
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000196
Family Pseudo ankyrin repeat 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A285Q2W7
Sequence length 237
Comment (tr|A0A285Q2W7|A0A285Q2W7_9VIRU) Ankyrin repeat {ECO:0000313|EMBL:SOB74380.1} OX=2023205 OS=Cedratvirus lausannensis. GN=BQ9231_00497 OC=Viruses; dsDNA viruses, no RNA stage; unclassified dsDNA viruses.
Sequence
MNSMLVDFLKDFGSRLIDPLFDAFVQTGMKYVEEKSNISSANFCKQSLALGCSLEQLQAI
YKRGYPLSGNFFSALMKRDDLSSQQKIEFLTWFQEKCIRFTSKDLVKAAKENEVEIVEWF
CEQTDCAELCMDDRVLAYLALHGHDADYIDKMRDRGFICTSEVMAKASMGNQLTLMKELH
ERGYHMDGRVLSFAAMNDNLEMFTWAIECGLSVNQDCKTYANIYSSSIRDHIMEQGW
Download sequence
Identical sequences A0A285Q2W7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]