SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A286XW03 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A286XW03
Domain Number 1 Region: 1-125
Classification Level Classification E-value
Superfamily MAL13P1.257-like 4.05e-42
Family MAL13P1.257-like 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A286XW03
Sequence length 140
Comment (tr|A0A286XW03|A0A286XW03_CAVPO) Chromosome 1 open reading frame 123 {ECO:0000313|Ensembl:ENSCPOP00000029464} KW=Complete proteome; Reference proteome OX=10141 OS=Cavia porcellus (Guinea pig). GN=C1orf123 OC=Hystricomorpha; Caviidae; Cavia.
Sequence
MGKIALQLKATLENITNLRPLGEDFRWYLKMKCGNCGEISEKWQYIRLMDSVALKGGRGS
ASMVQKCKLCARENSIGKSDNEKFKTIVEFECRGLEPVDFQPQAGFAAEGVESGTVFSDI
NLQEKVCDLGILQVCRWPCL
Download sequence
Identical sequences A0A286XW03

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]