SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A287A636 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A287A636
Domain Number 1 Region: 37-76
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000863
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A287A636
Sequence length 92
Comment (tr|A0A287A636|A0A287A636_PIG) Uncharacterized protein {ECO:0000313|Ensembl:ENSSSCP00000039279} KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=RIIAD1 OC=Sus.
Sequence
MASLPGGTHGLYPEALSPEQLEQLRGYKIQIRITNEKYLRTHKEVELLVSGFFREIFLQR
PDNIQEFAADYFTDPRLPNKIHMQLIKEKKAA
Download sequence
Identical sequences A0A287A636
9823.ENSSSCP00000007056 NP_001153237.1.46622 XP_013852592.1.46622 ENSSSCP00000025115 ENSSSCP00000025300 ENSSSCP00000025115 ENSSSCP00000025300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]