SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A287A8N4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A287A8N4
Domain Number 1 Region: 48-114
Classification Level Classification E-value
Superfamily Interleukin 8-like chemokines 1.05e-22
Family Interleukin 8-like chemokines 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A287A8N4
Sequence length 119
Comment (tr|A0A287A8N4|A0A287A8N4_PIG) C-X-C motif chemokine {ECO:0000256|RuleBase:RU361149} KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=PPBP OC=Sus.
Sequence
MSLRLGAISSCTTSSPFPVLQVLLPLSLLLTTLVPATMGAAKIEGRMAHVELRCLCLNTV
SGIHPSNIQSLEVIRAGAHCAKVEVIATLKKGHKICLDPQNLLYKKIIKKLLKSQLLTA
Download sequence
Identical sequences A0A287A8N4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]