SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A287AEK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A287AEK2
Domain Number 1 Region: 239-382
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.71e-35
Family cAMP-binding domain 0.00000165
Further Details:      
 
Domain Number 2 Region: 105-235
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.96e-32
Family cAMP-binding domain 0.000000978
Further Details:      
 
Domain Number 3 Region: 2-44
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000000497
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A287AEK2
Sequence length 389
Comment (tr|A0A287AEK2|A0A287AEK2_PIG) cAMP-dependent protein kinase type II-alpha regulatory subunit {ECO:0000313|Ensembl:ENSSSCP00000042250} KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=PRKAR2A OC=Sus.
Sequence
MSHIQIPPGLTELLQGYTVEVLRRQPPDLVDFAVDYFTRLREARSRASTPPAAPPSGSQD
LEPSSGLVTDAIADSESEDDEDLDVCAETYNPDEEEEDTDPRVIHPKTDQQRCRLQEACK
DILLFKNLDQEQLSQVLDAMFERTVKVDEHVIDQGDDGDNFYVIERGTYDILVTKDNQTR
SVGQYDNHGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESF
IESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQGEKADSFYIIESGEVSILIKSKTK
ANKDGGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCM
DIMKRNISHYEEQLVKMFGSSMDLIDPGQ
Download sequence
Identical sequences A0A287AEK2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]