SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A287AFZ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A287AFZ3
Domain Number 1 Region: 149-267
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.36e-33
Family cAMP-binding domain 0.00000128
Further Details:      
 
Domain Number 2 Region: 278-402
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.68e-32
Family cAMP-binding domain 0.00000082
Further Details:      
 
Domain Number 3 Region: 45-92
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 8.37e-19
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A287AFZ3
Sequence length 411
Comment (tr|A0A287AFZ3|A0A287AFZ3_PIG) Protein kinase cAMP-dependent type I regulatory subunit beta {ECO:0000313|Ensembl:ENSSSCP00000042766} KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=PRKAR1B OC=Sus.
Sequence
MHVCGAGVLTLRGPHDCVSSAGSGQQAAVAMASPSPHQLEEDDSLRGCELYVQKHGVQQV
LKDCIVQLCVSKPARPMKFLREHFEKLEKEENRQILAQQKSASQSDLYDEEVSPPLPNPV
VKARHRRGGVSAEVYTEEDAVSYVRKVIPKDYKTMTALARAISKNVLFAHLDDNERSDIF
DAMFPVTHIAGETVIQQGDEGDNFYVVDQGEVDVYVNGEWVTSISEGGSFGELALIYGTP
RAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRRVYQEFLSKVSILESLEKWERLTVADA
LEPVQFEDGEKIVVQGEPGDDFFIITEGTASVLQRRSPNEEYVEVGRLGPSDYFGEIALL
LNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLTV
Download sequence
Identical sequences A0A287AFZ3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]