SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A287AKE5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A287AKE5
Domain Number 1 Region: 91-186
Classification Level Classification E-value
Superfamily PDZ domain-like 5.13e-30
Family PDZ domain 0.015
Further Details:      
 
Domain Number 2 Region: 16-67
Classification Level Classification E-value
Superfamily L27 domain 3.61e-24
Family L27 domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A287AKE5
Sequence length 201
Comment (tr|A0A287AKE5|A0A287AKE5_PIG) Protein lin-7 homolog {ECO:0000256|PIRNR:PIRNR038039} KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=LIN7C OC=Sus.
Sequence
EEQARPSWDHQLCTTPDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEH
VYETVDISSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSP
IYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGKVKLVVRYTPK
VLEEMESRFEKMRSAKRRQQT
Download sequence
Identical sequences A0A287AKE5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]