SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A287B2U0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A287B2U0
Domain Number 1 Region: 74-163
Classification Level Classification E-value
Superfamily Interleukin 8-like chemokines 3.14e-18
Family Interleukin 8-like chemokines 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A287B2U0
Sequence length 202
Comment (tr|A0A287B2U0|A0A287B2U0_PIG) C-C motif chemokine 25 {ECO:0000313|Ensembl:ENSSSCP00000050758} KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=CCL25 OC=Sus.
Sequence
MPRATCLPCRGPRLEIGLPPCLLLCILGPHRPTHPHFLVNPRGAGGGPACTMRPWLLACL
VACFVGAWAPAIHAQGAFEDCCLAYHSHIKWRLLRRAHSYQRQDVSGSCNLPAVIFFFPQ
KDKMVCGKPGAKWVQFGMKILDNRNKKDSKPHHSGRRFFQGPQSGVRKLSSGTSRPLLLK
FSGPTRSSKRKASLLTTAIPGP
Download sequence
Identical sequences A0A287B2U0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]