SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A287DF89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A287DF89
Domain Number 1 Region: 268-411
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.8e-33
Family cAMP-binding domain 0.000000197
Further Details:      
 
Domain Number 2 Region: 134-265
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.89e-33
Family cAMP-binding domain 0.000000172
Further Details:      
 
Domain Number 3 Region: 2-43
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000706
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A287DF89
Sequence length 417
Comment (tr|A0A287DF89|A0A287DF89_ICTTR) Protein kinase cAMP-dependent type II regulatory subunit beta {ECO:0000313|Ensembl:ENSSTOP00000032214} KW=Complete proteome; Reference proteome OX=43179 OS=(Spermophilus tridecemlineatus). GN=PRKAR2B OC=Sciuridae; Xerinae; Marmotini; Ictidomys.
Sequence
MSIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQQENERKGAARFGHEGRTWGD
AGAAAGGGTPSKGVNFAEEPMRSDSENGEEEEEAADAGAFNAPVINRFTRRASVCAEAYN
PDEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKEGEHV
IDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSP
GALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEVSERLKVVDVIGTKVYNDGE
QIIAQGDLADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCSRGQYFGELALVTNKPR
AASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA
Download sequence
Identical sequences A0A287DF89
ENSSTOP00000012399 ENSSTOP00000012399 XP_005319513.1.77405 XP_015343832.1.40921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]