SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A287DFL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A287DFL3
Domain Number 1 Region: 40-119
Classification Level Classification E-value
Superfamily EF-hand 0.00000499
Family Polcalcin 0.045
Further Details:      
 
Domain Number 2 Region: 9-49
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000994
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A287DFL3
Sequence length 133
Comment (tr|A0A287DFL3|A0A287DFL3_ICTTR) EF-hand calcium binding domain 10 {ECO:0000313|Ensembl:ENSSTOP00000032334} KW=Complete proteome; Reference proteome OX=43179 OS=(Spermophilus tridecemlineatus). GN=EFCAB10 OC=Sciuridae; Xerinae; Marmotini; Ictidomys.
Sequence
MEAPVSREQEAGYYLKSHRIMDLLNHLTSVLLFVRPENPREYLISVLECMKIAKETNVAF
PYFMDNSNITAMFEMLDNSGKGTISFVQYKEALKTLGLCDADEDLKDDGHIINLNRFKEE
VNKRNREIWSSFW
Download sequence
Identical sequences A0A287DFL3
XP_005319575.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]