SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A287ER58 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A287ER58
Domain Number 1 Region: 200-260,295-426
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.12e-31
Family Ankyrin repeat 0.00056
Further Details:      
 
Domain Number 2 Region: 93-221
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000392
Family Pseudo ankyrin repeat 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A287ER58
Sequence length 661
Comment (tr|A0A287ER58|A0A287ER58_HORVV) Uncharacterized protein {ECO:0000313|EnsemblPlants:HORVU1Hr1G016540.38} KW=Complete proteome; Reference proteome OX=112509 OS=Hordeum vulgare subsp. vulgare (Domesticated barley). GN= OC=Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum.
Sequence
MGCFPFIVLDWQHNVAPAVCIRPQLEAAYQKHKLFEMLETKRNTTQLFASTFSKKSLLAR
YIADKWQSDFSYWESVLVFHFYLQEPLIMQGREGNTLLHEAVIHGWHDLVVSLLDHGKEV
TWTATEEFIKEYHEYAGDVVSTHDVLLVISNDDGDTPLHLAVKSGNSVLVNMLIGRTKVM
NLELTPQYAKGPIIMANKLGNTPLHNAVLQRKSDIALKLLEANPGCAHMSNAARQSPFYI
AVRDGLTYVVKKIADQKMVVAFMSTQANPLHESVLGDNIRKQVYIVLNRYEELVELSDLL
GNNALHYAAEKNNARIVSILLNKNHTLAYKQNNEKHTPLHIAAYYGSTEAAKELLKQFPD
VIEMVDNMGRNALHIAAINDKVSVLELLLKYVLPKEIVNQQDRDGNTPLHHAGKLLRKQA
ALLLLNDRRVKPCLVNHDEDAAFSLSKSCLVNQDEDAVVSLSQRIGIERTYSKSKQLILT
KQQPRPLQNRRTSPRMERKIVYSVLVVVATLISMATFAVTLTLPGGYNQQSGAAIVGHHQ
AFNILVICNTISMCSSTVVALCAFLWKDRAEARISYGVMLFGAKLLIVFSGLTMIMSMLT
AIYLTIAPVLVAYVGVAIGAGVPLLVCLVVVLRKNLSIRSVFSIFERRRTETSGVERRNG
R
Download sequence
Identical sequences A0A287ER58

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]