SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A287T430 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A287T430
Domain Number 1 Region: 72-147
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 3.01e-33
Family Skp1 dimerisation domain-like 0.000022
Further Details:      
 
Domain Number 2 Region: 1-60
Classification Level Classification E-value
Superfamily POZ domain 7.06e-23
Family BTB/POZ domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A287T430
Sequence length 149
Comment (tr|A0A287T430|A0A287T430_HORVV) Uncharacterized protein {ECO:0000313|EnsemblPlants:HORVU6Hr1G000640.16} KW=Complete proteome; Reference proteome OX=112509 OS=Hordeum vulgare subsp. vulgare (Domesticated barley). GN= OC=Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum.
Sequence
MITLKSSDGEEFEVEEAVAMESQTIRHMIEDDCADNGIPLPNVNSKILSKVIEYCNKHVH
AAAAPAAPAEDLKNWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQTVADMIKGKTPE
EIRKTFNIKNDFTPEEEEEIRRENQWAFE
Download sequence
Identical sequences A0A287T430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]