SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A288QW30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A288QW30
Domain Number 1 Region: 140-289
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.09e-31
Family Inhibitor of apoptosis (IAP) repeat 0.00042
Further Details:      
 
Domain Number 2 Region: 22-102
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 5.5e-22
Family Inhibitor of apoptosis (IAP) repeat 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A288QW30
Sequence length 315
Comment (tr|A0A288QW30|A0A288QW30_9ABAC) Iap1 {ECO:0000313|EMBL:AOT85579.1} OX=1906244 OS=Cyclophragma undans nucleopolyhedrovirus. GN= OC=unclassified Alphabaculovirus.
Sequence
MNDADAQIFAPVYLINVCETMQHNIEHLFETLVDRHNSFENYPINDTEFINNLIVNGFKY
NQIDDHVVCQYCDVEIGNWSANDRIEYVHAALSPHCLYARKAVQHSDASAPPFDTIEAIA
AAVAPCPTKTILIKRGKIKCMYSCMSNVQARVNTFADHWPAVLRGLVTDIADAGLFYNGR
GDETVCFFCDCRVHEWHAGDDAWRRHALANSQCYFLVSVKGAEFCNNLNIAVSTNFKNED
DSGGDDDDDADNNNDSKRVDDATYHVCTVCWERQRDAVLLPCRHFCICVQCYFGLRDKCP
TCRQEVVDFIKVFVT
Download sequence
Identical sequences A0A288QW30

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]