SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A291ATH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A291ATH3
Domain Number 1 Region: 82-121
Classification Level Classification E-value
Superfamily F-box domain 0.0000034
Family F-box domain 0.0078
Further Details:      
 
Domain Number 2 Region: 151-221
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000119
Family Pseudo ankyrin repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A291ATH3
Sequence length 248
Comment (tr|A0A291ATH3|A0A291ATH3_9VIRU) F-box domain {ECO:0000313|EMBL:ATE82190.1} KW=Complete proteome; Reference proteome OX=1349410 OS=Pandoravirus salinus. GN=psal_cds_534 OC=Viruses; dsDNA viruses, no RNA stage; unclassified dsDNA viruses.
Sequence
MSTIRPKISNQKGSWSLSSRRRRAQPTQANRSCPHAHNHMQGETQVLSTKSKARRRARDD
NPARPKRRRSSNPKVMDTVDLGPGINDLPDEVLVMILSKVDILMGPVLPFVCSRWRAVFG
DITTRRSKERPPRQEEKDPAAYTAALAGAGYTSVLMWARSAGCPWDQRVCAEAAEQGHLD
LLVQARARRCPWNGDTCNMAASNRDLNMLKWARANGCPWDYRVATWAYHNQDTQILEWAK
NNGLDGLY
Download sequence
Identical sequences A0A291ATH3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]