SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A291AU70 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A291AU70
Domain Number 1 Region: 197-378
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000124
Family Ankyrin repeat 0.0034
Further Details:      
 
Domain Number 2 Region: 74-125
Classification Level Classification E-value
Superfamily F-box domain 0.00000000068
Family F-box domain 0.0037
Further Details:      
 
Domain Number 3 Region: 131-190
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000327
Family Pseudo ankyrin repeat 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A291AU70
Sequence length 407
Comment (tr|A0A291AU70|A0A291AU70_9VIRU) Ankyrin repeat {ECO:0000313|EMBL:ATE82560.1} KW=Complete proteome; Reference proteome OX=1349409 OS=Pandoravirus dulcis. GN=pdul_cds_885 OC=Viruses; dsDNA viruses, no RNA stage; unclassified dsDNA viruses.
Sequence
MWLRTAVAPASAPAALFVSLRTSCPSADWRSHYVTRPDQEKKKERKKESQTRACKSAGRD
RSASAHCCVSMMMSFDALPDELVTAVLARLSCVDLCQGAVRVCWRWNRIIHDPPALGRTL
CTADGAPANKTDADAAAYRMAARAGHVSCLERLGESAPHRWGDGRCLVEAAERDHLACLR
YAHEHGCPWRDAVCEVASAHGHVDCLRYAHEHGAFWIGHCHEAAENGHIAILYYAKEKGI
THDLDVCWLAARSGRLDILRYAVTSGWRICVAAMYSAARQGHLDCVRYLHEVSADGVLVP
PCSSAALGGRLDCLRYLHEHGYAWGSNLTRMAAKKGHLDCLRYAHERGCAWHPRTCATAA
KRGHLDFLRYAHEHGCPWGTATCARLEAAGADPACVQYARDNGCPID
Download sequence
Identical sequences A0A291AU70

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]