SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A292PNC9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A292PNC9
Domain Number 1 Region: 29-104
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 2.35e-16
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0022
Further Details:      
 
Domain Number 2 Region: 105-211
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000045
Family Cold shock DNA-binding domain-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A292PNC9
Sequence length 224
Comment (tr|A0A292PNC9|A0A292PNC9_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:CUS08614.1} OX=59557 OS=Tuber aestivum (summer truffle). GN=GSTUAT00007260001 OC=Pezizales; Tuberaceae; Tuber.
Sequence
MFILVTSPLSFMKKQKKKKTQINPTFPNFQQSKFTDLLHLPPPTFAHPTATALEDRINEK
YANKVVHNVGLCISLYDLSKVSEGMIGQDGGAHVNVEFRMIVFRPFKGEVLTGRISSATA
AGVKVRTDFFDEVFVPATGLFEGSRLYVWIWHNDDQDFYMDKNEVIRFRVEGEIFVDQLP
VPPHLKGEESSLHNKPPYAITASCQQAGLGLVSWWVEEDGEEGE
Download sequence
Identical sequences A0A292PNC9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]