SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A292QMZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A292QMZ6
Domain Number - Region: 42-102
Classification Level Classification E-value
Superfamily STI-like 0.0589
Family Clostridium neurotoxins, C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A292QMZ6
Sequence length 275
Comment (tr|A0A292QMZ6|A0A292QMZ6_9BACT) Uncharacterized protein {ECO:0000313|EMBL:DAA81799.1} KW=Complete proteome OX=1916217 OS=Candidatus Gastranaerophilales bacterium HUM_3. GN=CPT90_10710 OC=Bacteria; Candidatus Melainabacteria; Candidatus Gastranaerophilales.
Sequence
MFKPIVCKAKTNITIPYSGTKKEKLEFIDRTARTFCENFDTYLQINNQKNFIKKKELIAL
FSELFPGLKINIGRVSSKEAGTDAATRREADCYIMRLKPRKSKNILVNILDYFRPLMIEK
NTDNIESIKHETCHIISQSVRGNAFKNNDIRDFMARNGEFLEDMRFLLEERTNLSIFPAF
YFQNKYKNKLLELFKNYKVNEYKQIHILSTLKRLIEEEKLAYNISTHGKSTTIDDINDRA
YKVEKFLAFNKKLEVINSALKQKLINIRSNKKDLR
Download sequence
Identical sequences A0A292QMZ6 R5SE74

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]