SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A292RHH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A292RHH5
Domain Number 1 Region: 135-238
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.00000000000775
Family HD domain 0.057
Further Details:      
 
Weak hits

Sequence:  A0A292RHH5
Domain Number - Region: 81-130
Classification Level Classification E-value
Superfamily MW0975(SA0943)-like 0.0126
Family MW0975(SA0943)-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A292RHH5
Sequence length 277
Comment (tr|A0A292RHH5|A0A292RHH5_9BACT) HD domain-containing protein {ECO:0000313|EMBL:DAA97719.1} KW=Complete proteome OX=1916229 OS=Candidatus Gastranaerophilales bacterium HUM_10. GN=CPT96_12090 OC=Bacteria; Candidatus Melainabacteria; Candidatus Gastranaerophilales.
Sequence
MFSTDITYEVVTFSIGDTKSGSKMGKLQLKDPQTGEFLNCILWEEALNRMDTKLFRCGNL
LRIAAGSFNEKYNNCLVSALELIKEAKTGLDEKEREKEFENLIEYINKIKDEKLKNFVLE
IYTANKDKILVMPAAKLMHHNYIGGLMVHTLECLKYAEINMDAFFQRVNRDEVYAACLLH
DIGKIFEYTIDTESGLIDYDENFRKEWISHSQYGFSICMTAGFKRVAKMIAAHHGRADWG
AIVDLNEKDLEPFVYLIHHIDDLSAKFGKTNVAMLGG
Download sequence
Identical sequences A0A1Q6TQA7 A0A292RHH5 R5SY70

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]