SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A293LIN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A293LIN5
Domain Number 1 Region: 24-287
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.89e-49
Family Ankyrin repeat 0.00034
Further Details:      
 
Domain Number 2 Region: 264-332
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000051
Family Pseudo ankyrin repeat 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A293LIN5
Sequence length 477
Comment (tr|A0A293LIN5|A0A293LIN5_ORNER) Uncharacterized protein {ECO:0000313|EMBL:MAA27691.1} OX=265619 OS=Ornithodoros erraticus (European soft tick) (Alectorobius erraticus). GN= OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Argasidae; Ornithodoros.
Sequence
MPSGPCLQTLQRELADSIIRCAPLDELRILLACGARVNEPVTQGLRPLHYAAYRRYDEAV
NLLLVRGCDVDATDDVGYTALHLCAERGFKDTADLLLKHQAKVCFTDQPCKTNSKQPLGN
PPRSTLADEPLRLALKNGHYECAELLLLAGADPNARYFLGCEINLVSPLDLRSLVLLLRY
GALPDARDRTGLTPLMKAARHPKGLDAVRLLVAHGADVNADTTERHDCRTVLHYAVLSGN
AETVRFLLDAGAKAVVPPGYHYPTPLDFAVLRGQLEVARMLLDAGAHPDAGGSAIVGSPL
HLALCEAPMPTRFPLVQLLLERGADPNALTFSERGGPLLRTPLGEYLASSDDTPCSPCLV
RLLLKFGARAVLRPQARHPLGILRCLTRVKQEDVLEVVVDASEGLDRATIQRNLQLGPEA
RRVLMEASSSPRPLKHLARLRVRIALGVTGPQLLSKGYQLMASPLPAPLVRYLLYET
Download sequence
Identical sequences A0A293LIN5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]