SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A293MZ45 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A293MZ45
Domain Number 1 Region: 17-86
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000837
Family HLH, helix-loop-helix DNA-binding domain 0.0043
Further Details:      
 
Domain Number 2 Region: 94-136
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000772
Family Hairy Orange domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A293MZ45
Sequence length 246
Comment (tr|A0A293MZ45|A0A293MZ45_ORNER) Uncharacterized protein {ECO:0000313|EMBL:MAA45409.1} OX=265619 OS=Ornithodoros erraticus (European soft tick) (Alectorobius erraticus). GN= OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Argasidae; Ornithodoros.
Sequence
MTMPPTERGFGFVHQQSRAETRRASKPLMEKRRRARINHSLSQLKSLLLDGATRKETQNS
RHAKLEKADILEMTVKHLRNVQQKCAVPTSTQELETRFQAGFAECAREVMRFASDVQVDA
SIRSRLLGHLASCLASLPTPDSLPDVPVETSRLVVKTEPPTDAYCSGSQYEQQELRAISP
LNLATTSSRSASSASPTISMPASPYSDTDSTASTSDDFAEMRLEGQICSVIRRAPALSSD
PVWRPW
Download sequence
Identical sequences A0A293MZ45

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]