SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2A2J0X2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2A2J0X2
Domain Number 1 Region: 526-719
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.5e-18
Family Nucleotide and nucleoside kinases 0.00033
Further Details:      
 
Domain Number 2 Region: 147-328
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000121
Family Nucleotide and nucleoside kinases 0.00095
Further Details:      
 
Domain Number 3 Region: 4-46
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000628
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2A2J0X2
Sequence length 740
Comment (tr|A0A2A2J0X2|A0A2A2J0X2_9BILA) Uncharacterized protein {ECO:0000313|EMBL:PAV55598.1} KW=Complete proteome; Reference proteome OX=2018661 OS=Diploscapter pachys. GN=WR25_09935 OC=Rhabditoidea; Diploscapteridae; Diploscapter.
Sequence
MGAEARVYLQEHSIPQLFEGLMTGLLYNRPEDPLRFLEDAIGHIRKHPNEAVAWDTFLNN
KEPHKGKQSKSKRKEPKEAVTSTKDKDKGEKSEKGEKKHSKSSKKSEEKHEKKQSVEVVE
QEGEEPQQQMVLHRTPSVIRAAEVAQIPNVPVILFMGGPGGGKTRHAAKVANALSSNGLV
HICMPDVIRNALSKYKDRYPEWKDANENYLRGELIPNNLALSLLKAEMGRHPDAAAFFLE
GFPREARQVEDFERQVKSVNMAMILDYDERTLRDHMERRGLGMEIVDQKIKEFKQKTLPS
AKYFDDQKLLHLIPGEKDDQTIYERMKGLVVRAIDTGIPVLSNQSVDEADTRLQSAQSGT
TRSPKTNGSPLTRPTQSQEEVIRNESRVEVGRESVLPPINSTPPKSTSPEKEKELSRKSS
KDSTALPPINNSNNSKPSSRPTSQAVARNSEKRDSASSSQRSIPPSRNSANPAADSKRIG
SRQETIKTNGASTANSEERKSAVITPNQASKASTIQDAVPQSLPNNAPVVLIIGAPGSQK
QDIARRVAQKYDGFTMFSMGDLLRRKVSEMKEDELWQRIGKKIDVGESVPLKICRQVLYN
EIHNVGASSWGFVIEGFPRTQTQLNDMEHTLGRLDVAILIDCTEQFCMEVVRKRREAHRN
ARPDDEPDVLAIRMDMFKQNALPMLKYLDDKGKLRVVRGGTIDGDFDADIVFKDVSTAID
HTLFIEDDGSGKSLGDSKSN
Download sequence
Identical sequences A0A2A2J0X2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]