SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2A2KTQ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2A2KTQ1
Domain Number 1 Region: 1-111
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.13e-38
Family Calponin-homology domain, CH-domain 0.0000071
Further Details:      
 
Domain Number 2 Region: 235-269
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.00000000772
Family EB1 dimerisation domain-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2A2KTQ1
Sequence length 283
Comment (tr|A0A2A2KTQ1|A0A2A2KTQ1_9BILA) Uncharacterized protein {ECO:0000313|EMBL:PAV77217.1} KW=Complete proteome; Reference proteome OX=2018661 OS=Diploscapter pachys. GN=WR25_12778 OC=Rhabditoidea; Diploscapteridae; Diploscapter.
Sequence
MLLWVNDCLQSNFTKLEQLHTGAGYCQFTDFLFPDTLPLKKVKWNSKNELDWLANWKLVQ
TAWKSLGVEKVVPVDKLIKGKFQDNFEFLQWFKKFFDANYDGHEYNPLEARSGEPLPTEG
AGAAKPGAASRMPTRAPVQARPAAVPATSSRNNSNQALNTTSTTQPARRAPPGAPAHLPA
SVTPARPTPTRATSGVGATPANGSNGVKTPMTRPTGGVPQQPAVDPAQVKQLKAEVEEAN
RQLTEMDTVVASLEKERDFYFSKLRSIEVGILIIFKIIVGKND
Download sequence
Identical sequences A0A2A2KTQ1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]