SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2A2TIW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2A2TIW9
Domain Number 1 Region: 1-100
Classification Level Classification E-value
Superfamily XisI-like 3.66e-30
Family XisI-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2A2TIW9
Sequence length 105
Comment (tr|A0A2A2TIW9|A0A2A2TIW9_9CYAN) XisI protein {ECO:0000313|EMBL:PAX54539.1} KW=Complete proteome; Reference proteome OX=987040 OS=Calothrix elsteri CCALA 953. GN=CK510_12290 OC=Bacteria; Cyanobacteria; Nostocales; Rivulariaceae; Calothrix.
Sequence
MDRIEEYRQILCDFLQEFATNDVQAQLIFDPVRDRYLVMHNEWRDEYRIYGCAMQLDIIE
GQIWIQHNSTEIYIDRELIQRGVDRKDIILGFRSPGVRKLLAANN
Download sequence
Identical sequences A0A2A2TIW9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]