SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2A3EAZ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2A3EAZ3
Domain Number 1 Region: 8-46
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000314
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2A3EAZ3
Sequence length 1262
Comment (tr|A0A2A3EAZ3|A0A2A3EAZ3_APICC) Sperm surface protein Sp17 {ECO:0000313|EMBL:PBC28231.1} OX=94128 OS=Apis cerana cerana (Oriental honeybee). GN=APICC_07945 OC=Apoidea; Apidae; Apis.
Sequence
MDCIIAPRVPRGLAHAVEGLSREILRQKPRNIYAFAAQHFAKLVELRDKEHCRTDEIVSK
ILGCKSVNRECDNILDWAGFNKNVVDGNNDVGDVRNWNDRFFVCKYDNWMEKEMISTIKE
RRETNAIPKKKKREMGTGIGWSINQTVKVLKKHEYATCRVEESENLCDIRSKRREFEKIS
PDHIDNDSHQLSRKIICGQCFRSMSADNISLKRNIKDEEVKEKRKKLRNFALDKYGISKI
EEKCEKCERNAYNLIRQKSADQIERTCIHFKCGNGDGNIVGRRRSRSLVNNEGGKESNRN
VEEYRRELRWQYGIESGIFRNLKEQWRRITIEDEETEMRKLEEKLNDTEKEGVEKLGLRL
GKKCEKEELKNNEMEEDTFNDKSRNNEISNDVTNKMMTSIDRIDVSVMLPSVITRPSSSG
KFSTGRNIANYEFDERNNTNNFTLPPISNDGSKPMKKENDLTLPFLSNETDMRLNEETIR
YRGREESNSNRNRKDIEITANIDYDSKAIEKEHESENSKSDANDDNDSWKYHWDKCEENG
IVTGEKMEQNTDEIQILGELEILESSNLQMETEIEETFKDSLNVTPDSLEYLKKEEEEMK
EEKEEEEEEKKEQYRSNELERKLMEIETVEKSIENTLASSRTISTFNKELENSCLIKCNI
ERNLESQVLESVCKIDNENDTIIIENETRKQAVGEGDEWTRKNLDKSERVKSGESEEYNI
EIESMEKSEKNCSDDVEIFIRSDNNDEIVSSVRETCNHSPRREIDLSCYILTEGSPCEIP
ETVTTVIIPDKIEFEMDETNGENITNDIVVNDVPCWNKEKEYRDNRTNPFGEYVEHLETI
DDDHSSSVHAHFLQDIKNTVYRTSSLYQEDLLGNIKEEEENEREKFCNVTEQRSIDYTSE
SSQGKSSSCNEQYKIDTTNDTFHVFTNDASLRERGKKEERETWRSDRWDEFSLSFEQTEL
KLPEFSLNCSRDIETSTSSIQGNDSKNFDDDDDRSEKGNDDNVTLYEDENTFIGCKDKQP
IEEISLEKNECFQEELFIEQPPKNEAIEDKRNKIETSKFEDDKSIDMSVVYDKYGNDSHF
VEEEIARELIQNFILDASIIWENENESRDMTVFPLKDPISSTCKSGLNDFAIECHPFVQG
STLETTSDHLSYREEIDNDIRSCDEQIIKEKKKNEVEGRENGQETTEEKEEKEKAKETNM
NLNIDDIREPLAIDNTPRPIIIEEIANIDEEKKEICFEERMYDNECKNNIEKEKESSIHE
TD
Download sequence
Identical sequences A0A2A3EAZ3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]