SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2A3TAA4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2A3TAA4
Domain Number 1 Region: 1-62
Classification Level Classification E-value
Superfamily RNA polymerase subunit RPB10 3.79e-25
Family RNA polymerase subunit RPB10 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2A3TAA4
Sequence length 78
Comment (tr|A0A2A3TAA4|A0A2A3TAA4_9ARCH) DNA-directed RNA polymerase subunit N {ECO:0000256|HAMAP-Rule:MF_00250} KW=Complete proteome; Reference proteome OX=2026795 OS=Thaumarchaeota archaeon. GN=COA77_05240 OC=Archaea; Thaumarchaeota; unclassified Thaumarchaeota.
Sequence
MLIPVRCFTCGNMVADKFEDYQNKVKAGEDPKKVLDFLGIERYCCRRMLLTTVETIQQVI
PFYEAIQKRKEEVQSELE
Download sequence
Identical sequences A0A2A3TAA4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]