SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2A4JHD4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2A4JHD4
Domain Number 1 Region: 108-233
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.88e-34
Family cAMP-binding domain 0.0000111
Further Details:      
 
Domain Number 2 Region: 242-374
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.14e-33
Family cAMP-binding domain 0.0000541
Further Details:      
 
Domain Number 3 Region: 8-49
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000115
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2A4JHD4
Sequence length 384
Comment (tr|A0A2A4JHD4|A0A2A4JHD4_HELVI) Uncharacterized protein {ECO:0000313|EMBL:PCG70843.1} KW=Complete proteome; Reference proteome OX=7102 OS=Heliothis virescens (Tobacco budworm moth). GN=B5V51_2525 OC=Noctuoidea; Noctuidae; Heliothinae; Heliothis.
Sequence
MSRPQGGRIQVPDDLREILLEFTISYLLEQPGDVINYAVEFFTRLQNNRTTTVVRGPTAA
AGTPDESIISDEEEPPVARFNTRRKSVFAETYDPEEEDSDEGTTTVFPKSDAQRQRLAEA
VRSILLFRSLDAQQMQQVLDAMFEKRTEPGEYLIRQGDDGDNFYVIENGMFDVLVTGDDR
IEKVVHTYEGSGSFGELALMYNMPRAASVRAQTPGQLWAMDRHTFRRILLKSAYKKRKLY
EDLLEKVPMLKALQAYERANLADALLPRTLIDGELIIRQGDTADGMYFVEDGAVSIRITR
DDGNEHEIKRLEAGGYFGELALVTHKPRAASAYAVGPTRVAFLDVETFERLLGPCMEIMK
RNIDDYEEQLVKLFGDKSNLTDVR
Download sequence
Identical sequences A0A2A4JHD4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]