SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2A4JJG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2A4JJG7
Domain Number 1 Region: 108-229
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.02e-33
Family cAMP-binding domain 0.00000262
Further Details:      
 
Domain Number 2 Region: 237-361
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.17e-30
Family cAMP-binding domain 0.00000455
Further Details:      
 
Domain Number 3 Region: 7-54
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 1.11e-18
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2A4JJG7
Sequence length 372
Comment (tr|A0A2A4JJG7|A0A2A4JJG7_HELVI) Uncharacterized protein {ECO:0000313|EMBL:PCG72235.1} KW=Complete proteome; Reference proteome OX=7102 OS=Heliothis virescens (Tobacco budworm moth). GN=B5V51_996 OC=Noctuoidea; Noctuidae; Heliothinae; Heliothis.
Sequence
MEEEQCLHECENYIQSHNIPLLLKDCIVQLCVNKPDNPVSFLRQYFQKLEREQVKAAQAA
AAASEGEADGELSPLPVPGGQPPRRRGGISAEPVTEEDATSYVKKVVPKDYKTMGALSRA
IASNVLFTHLDESERADMFDAMFPVQCLPGETVIRQGDEGDNFYIIDSGEVEVLVNGEPV
TTIGEGGSFGELALIYGTPRAATVRARTPLKLWGLDRDSYRRILMGSTIRKRRMYDEFLS
RVSILESLEKWERLTVADALEPVSFTDGEIIVRQGEPGNDFYIIVEGTAVVLQQRSGQGE
GSAVEVGRLGPSDYFGEIALLLDRPRAATVRAAGSLKCVKLDRARFERVLGLCADILKRN
IAQYNSFVSLSV
Download sequence
Identical sequences A0A2A4JJG7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]