SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2A4ZWG2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2A4ZWG2
Domain Number 1 Region: 5-154
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.96e-24
Family SMI1/KNR4-like 0.0054
Further Details:      
 
Domain Number 2 Region: 144-210
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000131
Family Pseudo ankyrin repeat 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2A4ZWG2
Sequence length 240
Comment (tr|A0A2A4ZWG2|A0A2A4ZWG2_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:PCJ11402.1} KW=Complete proteome OX=1913989 OS=Gammaproteobacteria bacterium. GN=COB04_19135 OC=Bacteria; Proteobacteria; Gammaproteobacteria.
Sequence
MNIDSPNKYGKATEEKIQRFESMIGCELPIEYRNYLAKYNGGKPIPSNFDLENEEGLTLH
TMNSLSFDGKYYDHAWTYETFKGRIPKQLLPFGDDPGGNQICIGLKGKYKGKVYFWDHEE
DNLIFKFKGVSLVAESFNEFIDGLYEYIDLNETEIDRILRTRDFDVLERLLENGHDIEQE
NEYGRTLIEEASISANAEFINFLYEKGAELRESIALAEQNAKFFEEHKPIVELLGNLKRI
Download sequence
Identical sequences A0A2A4ZWG2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]