SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2A5JWZ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2A5JWZ1
Domain Number - Region: 9-86
Classification Level Classification E-value
Superfamily Gametocyte protein Pfg27 0.0484
Family Gametocyte protein Pfg27 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2A5JWZ1
Sequence length 109
Comment (tr|A0A2A5JWZ1|A0A2A5JWZ1_9BACL) Uncharacterized protein {ECO:0000313|EMBL:PCK69282.1} KW=Complete proteome OX=741161 OS=Paenibacillus larvae subsp. larvae B-3650. GN=PL1_1079 OC=Paenibacillus.
Sequence
MEALLDRLVKLYIKKSEKNLHYFFIPLAEEMRMWDGFNLFSYLMNSIISKEYIDQTIIKN
KIIVCKSAKSLSRLSNHNNILFLVETNQDNVIREDNDFAELEEVQIIQL
Download sequence
Identical sequences A0A2A5JWZ1 W2E3E8
WP_023483190.1.2936 WP_023483190.1.33316 WP_023483190.1.35586 WP_023483190.1.96379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]