SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2A5MUP1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2A5MUP1
Domain Number 1 Region: 6-144
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 4.39e-34
Family PA0094-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2A5MUP1
Sequence length 145
Comment (tr|A0A2A5MUP1|A0A2A5MUP1_ENTCL) DUF1795 domain-containing protein {ECO:0000313|EMBL:PCM69741.1} KW=Complete proteome OX=550 OS=Enterobacter cloacae. GN=CP904_22245 OC=Enterobacteriaceae; Enterobacter; Enterobacter cloacae complex.
Sequence
MSEPSSQCLFNEGMIAFPEGYQDRTVNVFAPPAADAPAFNISRDTLNSGEALAAYIDRQL
ALMEKHLKGWKQGERSAATLGDGLLQGEIIHASYLRDGKRIWQQQAVFNAEGDNILVFTM
TCTRTLGDTDCALFGDLLRSFRFHH
Download sequence
Identical sequences A0A2A5MUP1
WP_058651687.1.20623 WP_058651687.1.59627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]