SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2A6CF50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2A6CF50
Domain Number 1 Region: 268-355
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 4.03e-22
Family Sm motif of small nuclear ribonucleoproteins, SNRNP 0.011
Further Details:      
 
Domain Number 2 Region: 190-267
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease catalytic domain-like 1.03e-19
Family tRNA-intron endonuclease catalytic domain-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2A6CF50
Sequence length 360
Comment (tr|A0A2A6CF50|A0A2A6CF50_PRIPA) Gut-2 {ECO:0000313|EMBL:PDM76708.1} KW=Complete proteome OX=54126 OS=Pristionchus pacificus (Parasitic nematode). GN=PRIPAC_42103 OC=Neodiplogasteridae; Pristionchus.
Sequence
MSVDSATNSVTCAPPRVHFVNGSFVVFEKADADLLSNCHRILPDFGSSLEQLGPNSSNSC
YSCLLPEQVAVALDNGVITIVRLKRPVTIGNDEVPNEVEKPEIESLVLARKIAVGRKMKN
LKRKAQEEGTVQIKKLRLDDVMVTAEELNSALAEISVPLQARNAVQIRTNVSSKLAYESI
TFPEEFDTLDFRIRKIVFRDLWSRGFYVTSGVRFGCHFLVYKNPPGSVHADFMVRCVDAE
ADQTSTSMLSFARTANQVCKKSLLAILFFSFFKTLVGKEVVVELKNDLSICGTLHSVDQY
LNMKLLDISVTDQERFPHMLSVKNCFIRGSVVRYVHLPAEHVDTQLLQDATRKEIAANKK
Download sequence
Identical sequences A0A2A6CF50

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]