SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2A6CRE7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2A6CRE7
Domain Number - Region: 72-107
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0759
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2A6CRE7
Sequence length 121
Comment (tr|A0A2A6CRE7|A0A2A6CRE7_PRIPA) Dpy-30 {ECO:0000313|EMBL:PDM80601.1} KW=Complete proteome OX=54126 OS=Pristionchus pacificus (Parasitic nematode). GN=PRIPAC_35604 OC=Neodiplogasteridae; Pristionchus.
Sequence
MADNNEAPQEQIVNPEPEAMDTQTAAEEKPAETTAPPAEAPPTEPAAPAEAAPAPAAPAG
VTRVQSTMPTRQYLDTTVVPILLQALGALAKERPDCPIEFVANYLLREKERFASGPSGAT
N
Download sequence
Identical sequences A0A2A6CRE7 H3EW62
PPA14061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]