SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2A6YIH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2A6YIH4
Domain Number 1 Region: 2-179
Classification Level Classification E-value
Superfamily Cag-Z 2.88e-114
Family Cag-Z 0.0000000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2A6YIH4
Sequence length 199
Comment (tr|A0A2A6YIH4|A0A2A6YIH4_HELPX) Sodium:calcium antiporter {ECO:0000313|EMBL:PDX38732.1} KW=Complete proteome OX=210 OS=Helicobacter pylori (Campylobacter pylori). GN=BB399_06575 OC=Helicobacteraceae; Helicobacter.
Sequence
MELGFNEAERQKILDSNRSLMGNANEVRDKFIQNYATSLKDSNDPQDFLRRVQELRINMQ
KNFISFDAYYNYLNNLVLASYNRCKQEKTFAESTIKNELTLGEFVAEISDNFNNFMCDEV
ARISDLVASYLPREYLPPFIDGNMMGVAFQILGIDDFGRKLNEIVQDIGTKYIILSKNKT
YLTSLERAKLITQLKLNLE
Download sequence
Identical sequences A0A2A6YIH4
WP_017281241.1.39770 WP_017281241.1.47831 WP_017281241.1.87231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]