SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2A7MV75 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2A7MV75
Domain Number 1 Region: 53-244
Classification Level Classification E-value
Superfamily YfbU-like 6.54e-45
Family YfbU-like 0.0023
Further Details:      
 
Domain Number 2 Region: 2-39
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.000035
Family Arc/Mnt-like phage repressors 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2A7MV75
Sequence length 252
Comment (tr|A0A2A7MV75|A0A2A7MV75_9MYCO) Uncharacterized protein {ECO:0000313|EMBL:PEG35460.1} KW=Complete proteome; Reference proteome OX=39688 OS=Mycobacterium duvalii. GN=CRI77_25205 OC=Mycobacterium.
Sequence
MAVLNIRVEDRIRDQLKEMADAEGVTVSEYVRDLVMAAIVPVYEPPVRHGDEPAPETMRI
TDRQTLSLLHRILARVLPEDAKDEDGDAEYQLRRARVIESGFTGEYWREVAGFRTELSKR
DCGRVLDLLDMFRAITYSIKRLEQQGTTASKELRYQLEFRGFDHNDGLEGHMASYVEHLM
SDGRWAELQPQLKRHDDGNSHHRVLDTYTRMLAQHRRIKDSRSRGFDPDDYLLSIDELEQ
IAAARVHPSHRG
Download sequence
Identical sequences A0A2A7MV75 A1TA61
gi|120404238|ref|YP_954067.1| WP_011780466.1.45031 350058.Mvan_3262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]