SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2A8MGR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2A8MGR9
Domain Number 1 Region: 29-203
Classification Level Classification E-value
Superfamily MW0975(SA0943)-like 1.1e-23
Family MW0975(SA0943)-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2A8MGR9
Sequence length 203
Comment (tr|A0A2A8MGR9|A0A2A8MGR9_9BACI) Uncharacterized protein {ECO:0000313|EMBL:PET54763.1} KW=Complete proteome OX=2033480 OS=Bacillus sp. AFS001701. GN=CN514_17750 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MYKKFNSLFLVILILFILCSGCTSQAKQKNLVINQLAEIAKMEQKFQKAGERIQKLEIKE
LEYYEKIYLYKISEVNKRQESAKQAINLLNERKERVNEESKLIHDIDIKIKELQTINIET
KDEQFRNEVNNFIKTWRERTELYDKLNSKYKDAMETDLSIYNLLSQKKVDLKNVKSETKD
TNHIYKDVIKYNDQLNLYTQKLN
Download sequence
Identical sequences A0A2A8MGR9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]