SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2A8PQ70 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2A8PQ70
Domain Number - Region: 5-56
Classification Level Classification E-value
Superfamily RecG, N-terminal domain 0.0262
Family RecG, N-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2A8PQ70
Sequence length 56
Comment (tr|A0A2A8PQ70|A0A2A8PQ70_BACCE) DNA mismatch repair protein MutT {ECO:0000313|EMBL:PEV97012.1} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=CN425_24710 OC=Bacillus cereus group.
Sequence
MKNIIDDHVNKNIELYYAFIQFFSFITLQKVFVIEARKNELKKLMKNVQQKNPYYL
Download sequence
Identical sequences A0A2A8PQ70
WP_000789339.1.62978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]