SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2A9M5N4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2A9M5N4
Domain Number 1 Region: 65-127
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.000000327
Family EB1 dimerisation domain-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2A9M5N4
Sequence length 131
Comment (tr|A0A2A9M5N4|A0A2A9M5N4_9APIC) Uncharacterized protein {ECO:0000313|EMBL:PFH31621.1} KW=Complete proteome; Reference proteome OX=94643 OS=Besnoitia besnoiti. GN=BESB_025950 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Besnoitia.
Sequence
MFFKSRRFDGGRADVSPLAGSNDHYGQVGSFRRPPSLESSAALREQEVVGQTIAELQLLL
DLDEQCQQAARELKLQQLVLMRERNAYLKKLREIEGLCEARAWTDEQRNERELELLSLLK
EILYSEEAAPF
Download sequence
Identical sequences A0A2A9M5N4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]