SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2A9M631 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2A9M631
Domain Number 1 Region: 54-155
Classification Level Classification E-value
Superfamily LCCL domain 1.06e-17
Family LCCL domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2A9M631
Sequence length 256
Comment (tr|A0A2A9M631|A0A2A9M631_9APIC) PA14 domain-containing protein {ECO:0000313|EMBL:PFH33425.1} KW=Complete proteome; Reference proteome OX=94643 OS=Besnoitia besnoiti. GN=BESB_076420 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Besnoitia.
Sequence
MYVNGEDSGGSFEFLGTACSIPEEGVDREAEVPKVAIDVRVSQTITPVRYLPFVQSCATS
MEDIPVLVPVHEGEQFFAVCPRTCSLSPDGYVYGTDTYAPESSICKAALHSGACAALQAC
RVLVTVGSARKSFQASSQHGILSYAHGPSESSLGFSNMACAESLLARALVKYKVSFGTGS
SPSVNNFFTQTVCGSYHTSCQGWLLDEGKVKHRQNGVMYGKQLMHSIVIDRRSSPVQVGC
GLLNKRNALAPYFQTP
Download sequence
Identical sequences A0A2A9M631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]