SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2A9NWK1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2A9NWK1
Domain Number 1 Region: 149-171,241-323
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000353
Family Pseudo ankyrin repeat 0.031
Further Details:      
 
Weak hits

Sequence:  A0A2A9NWK1
Domain Number - Region: 300-396
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00144
Family Pseudo ankyrin repeat 0.043
Further Details:      
 
Domain Number - Region: 16-51
Classification Level Classification E-value
Superfamily SAP domain 0.00214
Family SAP domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2A9NWK1
Sequence length 404
Comment (tr|A0A2A9NWK1|A0A2A9NWK1_9AGAR) Uncharacterized protein {ECO:0000313|EMBL:PFH52103.1} OX=703135 OS=Amanita thiersii Skay4041. GN=AMATHDRAFT_74400 OC=Agaricomycetes; Agaricomycetidae; Agaricales; Amanitaceae; Amanita.
Sequence
MHLLHLSSPLQQVLSAYKKLSHTELVLFLKVRNLPTTGSTLDLASRLANHDLHTYHFPNV
STTPPPTTVFSSKQKRAPDLPMEILAYIMEHIGDWELAQAVGIPCCLSRPLEWQHASPSD
WAIVQGYLPRIRAADLLRTPPTKVGAVLAIRFGYVHVLEYFLSQHYLLFQSLFKGDLIPI
NASLYGRTSILSWWKHGFEQHPTLIPPPSPGSVAEAVDGASRNGQVAALDWWLNSGHRLE
YTVAALEYASAKNQIAVLEWWKTQHRERGLPLKVGRVLDMASMAGHVEVLEWWAASQIEF
KHDRNALQHASCHGKVDVLDWWLASGLQLYYDQEALVGATRHNRPEVLEWWDKSGLPIQY
RMCDIEEALEDAIGGGEDARAWWKQKGVDFNANDKEWMKLQSLN
Download sequence
Identical sequences A0A2A9NWK1
jgi|Amath1|74400|fgenesh1_pm.13_#_5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]