SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2A9PGD6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2A9PGD6
Domain Number 1 Region: 29-202
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 9.55e-30
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.0006
Further Details:      
 
Domain Number 2 Region: 392-502
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000124
Family Pseudo ankyrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2A9PGD6
Sequence length 594
Comment (tr|A0A2A9PGD6|A0A2A9PGD6_9HYPO) Uncharacterized protein {ECO:0000313|EMBL:PFH59972.1} KW=Complete proteome; Reference proteome OX=268505 OS=Ophiocordyceps unilateralis. GN=XA68_11647 OC=Ophiocordyceps.
Sequence
MAYYPSSASRLPPRPSSSSSLNEMRSQNRRLHLLVAATGPRDTSWAQALVVRLSKSPQIE
TRAIVDDVVPRLTQTIIVMENRSLVLGQGERADDIDFYRQQAYELVEWADLMVCVPLDAD
GIAKMLAGIADTLLGEVLRGWKIHKSVVLVPGMSTHMWTNPTTKRQLSKLHRRWNWVRVM
TPILWHYEGTPTPKRVPNWNGFNEVLGVIRNQADLLSLGRDVEVATDTGLVLGAGAGGAT
RVKAKLPPEIWTVVLDFAGDWELAKALGIYTNLPMPQPWRLEPKDSSDALQVYEHELEWT
VLTCSSAAICKKLSQSPPNFEDMSALVVKLVIRFALIQVLEYMEINRPDLFRAFDGTTLP
TNASAYYPRTDVLDYWKQSRWFRDKHVYDAEAVDGASKNGHVRVLDWWWRRSGLPLRYTE
TALEQASGKGHLLVLEWWRDAAAQDESIVLRPGRSLLWASQHGQAEVLRWWDASGIPVAH
GDSVAKVASRWGRVKVLETWRRLKGDSKLVFDAEVLISSTIHQHVEVLEWWRQFAHGELE
GMDGQKQPVEFRTCNIEEALEDSIGDQRKARRWWAQYGLDLRMRNQEWLQTRYL
Download sequence
Identical sequences A0A2A9PGD6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]