SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2B2I1I8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2B2I1I8
Domain Number - Region: 5-126
Classification Level Classification E-value
Superfamily BH3703-like 0.000288
Family BH3703-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2B2I1I8
Sequence length 151
Comment (tr|A0A2B2I1I8|A0A2B2I1I8_BACCE) DUF600 domain-containing protein {ECO:0000313|EMBL:PGM43275.1} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=CN296_20830 OC=Bacillus cereus group.
Sequence
MKEFEDRFSELQADMISICMEYVENRADKVYVYASCEEDMISSSFFYLINNKYVECHKVN
DALENGEERYDVSPERMFQVLQIISEDIEEIEILCKEYEKDMPTEMKLIYAAQSGKFKAE
YKYDLIHTNEDIKTADDFADEWFEEVKNNNL
Download sequence
Identical sequences A0A2B2I1I8 J7Y9K1 R8HXF8 R8LP60
WP_000657439.1.17940 WP_000657439.1.42182 WP_000657439.1.6996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]