SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2B4LWD7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2B4LWD7
Domain Number - Region: 437-464
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0719
Family Pseudo ankyrin repeat 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2B4LWD7
Sequence length 488
Comment (tr|A0A2B4LWD7|A0A2B4LWD7_BACCE) UPF0061 protein COL13_03075 {ECO:0000256|HAMAP-Rule:MF_00692} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=COL13_03075 OC=Bacillus cereus group.
Sequence
MTKNNETGWNLDNSYTTLPHSFYTEIPPTPVSSPELVKLNHSLAISLGLTPEELKKEVEI
AIFAGNAIPEGAHPLAQAYAGHQFGHFNMLGDGRALLIGEQITPSGERFDIQLKGSGPTP
YSRRGDGRAALGPMLREYIISEAMYALDIPTTRSLAVVTTGEPTYRETKLPGAILTRVAS
SHIRVGTFQYAAARGSIEDLKSLADYTIKRHYPEIEAHENRYTALLEAVIKKQASLIAKW
QLVGFIHGVMNTDNITISGETIDYGPCAFMDNYDQGTVFSSIDTQGRYAYGNQPYMAAWD
LARLAESLIPILHEDDEEALKIAQDEISKFSVQYENNWLLGMKKKLGLFGEDEQDKLLIE
KLLTIMEKYKADYTNTFRSLTLDTLKNTPLFESPAFKEWYGLWQSRLEKQDESKANAYEM
MKNNNPSIIPRNHRVEEALEAAVTNGDYSVMEKLLEALSNPYAYSADQEEYCVPPVPTNR
PYRTFCGT
Download sequence
Identical sequences A0A2B4LWD7 C2QEQ7
WP_000164909.1.83938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]