SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2B4R6H4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2B4R6H4
Domain Number 1 Region: 4-53
Classification Level Classification E-value
Superfamily LEM domain 0.000000000000262
Family LEM domain 0.00066
Further Details:      
 
Domain Number 2 Region: 92-137
Classification Level Classification E-value
Superfamily LEM domain 0.0000000000173
Family LEM domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2B4R6H4
Sequence length 306
Comment (tr|A0A2B4R6H4|A0A2B4R6H4_STYPI) Lamina-associated polypeptide 2, isoforms beta/delta/epsilon/gamma {ECO:0000313|EMBL:PFX13241.1} KW=Complete proteome; Reference proteome OX=50429 OS=Stylophora pistillata (Smooth cauliflower coral). GN=AWC38_SpisGene22697 OC=Astrocoeniina; Pocilloporidae; Stylophora.
Sequence
MSSFSDDPLTLTKDQLKRELKANGISLPRAEQKKSFYVDLYLEHFTSQNGDEEFSSDEEV
PQYSSMRASEKLPVKPPKKVTINKRVKGGLPFDVVALSDGDLARQLKSFGATVGPITEST
RPLYQKKLAKLLTEEKSSPAISAAVKVSPKQPKASPVKPKEEYVEFSDDNEVSSEEKEEE
AVEQLPYELDEEVQQNAGPKHLSYSRTSSPPSKATLRQRVAPSMTMRTQQTQEIFTKDPE
NNLSKENPAEMAAKKKTPELNKEENSICGPHIQILLAVGVFLVFTAFLIYHLMEDTPRLE
VKGDNS
Download sequence
Identical sequences A0A2B4R6H4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]