SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2B4RFK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2B4RFK5
Domain Number 1 Region: 113-237
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.7e-33
Family cAMP-binding domain 0.00000362
Further Details:      
 
Domain Number 2 Region: 247-377
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.96e-29
Family cAMP-binding domain 0.0000468
Further Details:      
 
Domain Number 3 Region: 4-42
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000000641
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2B4RFK5
Sequence length 388
Comment (tr|A0A2B4RFK5|A0A2B4RFK5_STYPI) cAMP-dependent protein kinase type II regulatory subunit {ECO:0000313|EMBL:PFX15579.1} KW=Complete proteome; Reference proteome OX=50429 OS=Stylophora pistillata (Smooth cauliflower coral). GN=AWC38_SpisGene20193 OC=Astrocoeniina; Pocilloporidae; Stylophora.
Sequence
MEMELEIPGGLTDLLQEFTYQVLSEKPDDIVEFAANYFMKLKIKEKRSKDGPKKKSKGVS
FHAEENGGDNSDDEDDEGDIEPPKNRYARRQSVCAEPLNPDSDDDGDENPIVYPKTDEQR
KRLNEAVKNILLFKNVAVEQLNEVLDAMFERKVQPGDHVIDQGDDGDNFYVIDKGIFDIY
VKIDGNDKLVGAYNGKGSFGELALMYNTPRAATIVATSEGILWALDRNTFRRILLKAAAK
KRKIHEKLLEQVPMLKEVTDYEIMNLADALQSRTFKDGDCVIQQGDEADCMFFVESGVAS
IRIRNQDDPTEEVELTQCTKGGYFGELALVTHKPRAASVYAVGDLITAVLDVHAFERLLG
PCMDIMKRNIDGYEDQLKKLGIGHTELR
Download sequence
Identical sequences A0A2B4RFK5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]