SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2B4RQK3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2B4RQK3
Domain Number 1 Region: 180-336
Classification Level Classification E-value
Superfamily Functional domain of the splicing factor Prp18 1.7e-52
Family Functional domain of the splicing factor Prp18 0.00019
Further Details:      
 
Domain Number 2 Region: 76-124
Classification Level Classification E-value
Superfamily PRP4-like 0.000000000000824
Family PRP4-like 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2B4RQK3
Sequence length 348
Comment (tr|A0A2B4RQK3|A0A2B4RQK3_STYPI) Pre-mRNA-splicing factor 18 {ECO:0000313|EMBL:PFX18512.1} KW=Complete proteome; Reference proteome OX=50429 OS=Stylophora pistillata (Smooth cauliflower coral). GN=AWC38_SpisGene17106 OC=Astrocoeniina; Pocilloporidae; Stylophora.
Sequence
MDFLLAEIDRKKKQIDQNEVTSNKKYFRRGDLVAKQAEDYRKKQEERLQQKEERAGKRAA
DDDIFAAFKRKKDENEAKSALIPREEVIRRLRERGEPIRLFAESDEEACQRLRRIEMLAP
EINKGLRNDFKAAMERVDQEYLAELIKQQGGEQQNSDSEESSQVEEDGTTLEDIKELAIN
MGKGDENLDQDVILKFIQFLLGLWAKDCKTRSDDSKRSLEAKLAGATQRQTESYLKPLLR
KLKNKKTPQDILGALTTIIMNLLDREYVKANDSYLQMAIGNAPWPIGVTMVGIHARTGRE
KIFAQNVAHVLNDETQRKYIQGLKRLMTFCQKKFPADPSKSVEYNAVK
Download sequence
Identical sequences A0A2B4RQK3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]