SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2B4S5B4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2B4S5B4
Domain Number 1 Region: 16-58
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000811
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0025
Further Details:      
 
Domain Number 2 Region: 134-223,261-283
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000319
Family Motor proteins 0.046
Further Details:      
 
Domain Number 3 Region: 266-331
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000114
Family Motor proteins 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2B4S5B4
Sequence length 401
Comment (tr|A0A2B4S5B4|A0A2B4S5B4_STYPI) Abnormal spindle-like microcephaly-associated protein-like {ECO:0000313|EMBL:PFX25884.1} KW=Complete proteome; Reference proteome OX=50429 OS=Stylophora pistillata (Smooth cauliflower coral). GN=AWC38_SpisGene9473 OC=Astrocoeniina; Pocilloporidae; Stylophora.
Sequence
MDEDTQVPTDSEDFRKRLTVPSGFRNLLEGLTVEILRCNPDNIYKFAADYFHTKLKERQE
KGYDDCLLGSQIDGYYRYEPSGASKRELDKAATKIQSTFRGHKVRQEAGALKETRNTGHR
QETPATAAENFGGKEHEAATCIQASYRGHNARQALKARNEAAITIQAGYRGYTVRKGLEE
GAISRPVRKDSPVSWREDEEAAALKIQSAFRGHRAREAIRSERNMDTGESGSKFIAADGN
AANDRDNMDESVDVDKDAKLGRDNAATTIQSNYRGYYAREQLRNKNSAATTIQANYRGYR
VRQIRRTRSEAAVTIQSYYRGYRTRESLKKRSSTKTYLEVSVSDEFALHRDSRTSFSLPV
GVKFEGNLDEDSDEEIDKMVDKLKAIQEASSPDLAEDKDDN
Download sequence
Identical sequences A0A2B4S5B4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]