SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2B4SEE2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2B4SEE2
Domain Number 1 Region: 363-589
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.92e-17
Family Nucleotide and nucleoside kinases 0.0055
Further Details:      
 
Domain Number 2 Region: 83-330
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.0000000000000015
Family Tyrosine-dependent oxidoreductases 0.019
Further Details:      
 
Weak hits

Sequence:  A0A2B4SEE2
Domain Number - Region: 665-701
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0366
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2B4SEE2
Sequence length 707
Comment (tr|A0A2B4SEE2|A0A2B4SEE2_STYPI) Adenylate kinase 7 {ECO:0000313|EMBL:PFX27190.1} KW=Complete proteome; Reference proteome OX=50429 OS=Stylophora pistillata (Smooth cauliflower coral). GN=AWC38_SpisGene8155 OC=Astrocoeniina; Pocilloporidae; Stylophora.
Sequence
MADLLNTDGDNPKRTLVFVNHVDLYTGKNISKILKGSVVGATAEEDEVNDDESQASGQPQ
IPKENCYKVVGTLQDPTQHKPEWVDEVFEYNTKEDLLPHLLECDIIVYDITGSPDQVDEA
TWAVSALHAELENFNTLKVFICLSTVMTWARSKPLDPDDPEISFTEDDYRRRRAHPNFKS
HISAEKLVIKHGKTNKSKFITYVVAAGLTYGSGEDIFHFLFKTAWHGQAPALQCFGNGQN
IVPTIHIKDLAAVIVNICDQNPKVRYLVAVDESKNTLEEIVKAVSAHLGNGRVKNITKEE
ALLIKELEQADFDLLLVNLRMDATYIKEGMNIIWVSESGLAENIDDVIKEYKETRGLLPL
RACIMGPPASGKTLVIKQLCEHYKLHHIKIQDAIDEAVDKLQRSAARAEAEEDDEDDLKA
QEDQEFLETLQDSRDRNSGRYEDQYIIRFYKDKLHSMPCQNQGFILDGYPKTYEQAKELF
AAEEGEEGEEDSPINYDKQIMPEVVVSLDAPDEFLKTRVMNLPESVVAGTHNTEEGLMRR
LAEFRASNTEDETVLNYFDELEIHPDHIDITQDKTRKMTKVVEQIKKLMGKPRNYGPTPD
ELAEMERIETEKRLQKERKAREEREKRDAEEAAERQRREEEWRVRLSEVKRQEQELLENQ
SIPLRNYLMKHVMPTLAQGLIECCKMRPDDPVDYLAEYLFKNNPQID
Download sequence
Identical sequences A0A2B4SEE2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]